Nocturnal Scratch Example 1


This example shows findings from assessments of the frequency and duration of nocturnal scratching episodes from a study of atopic dermatitis. Related endpoints in the DiMe Digital Endpoint Library are

  1. Change from baseline in number and duration of scratching episodes during sleep during first two weeks of dosing. [DIME Endpoint #122]
  2. Change from baseline in total sleep time, wake after onset (WASO), and sleep efficiency during the major rest period during first two weeks of dosing. [DIME endpoints #143/310, 124/290, 97]

In this study, subjects wore two accelerometer devices, one on each wrist. 

This concept map shows the modelling of the flow of data from the devices to the final summary measures.

Nocturnal Scratch

 


The following should be considered when viewing this resource:

  • The data from the devices was analyzed by a unit within the sponsor company, so that software has not been treated as a device,or included as a component of the Scratch Sensor System.  This is different from other examples, where processing software, even if not within the physical device, has been treated as a component of the overall device.
  • For each day, the analysis of device data included an assessment of whether data was usable for sleep summaries and an assessment of whether data was usable for scratch summaries. The values of these summaries were "PASS" or "FAIL".  If the value was "FAIL", the relevant summaries (of sleep or scratch) were not calculated.  In the SDTM datasets, the record for a "FAIL" day was represented with --STAT = "NOT DONE" and --REASND = "FAIL".
  • The summaries of sleep in this example include summaries of sleep, which have been represented in the Nervous System Findings (NV) domain. This is consistent with the presence of polysomnography sleep tests in the Nervous System Findings test name and test code codelists and the DHT Sleep example.
  • Terminology used for sleep measurements varies.  In this study, a "Major Rest Period" was identified, and within that period, Sleep Onset and Sleep Offset were identified.  For the SDTM NV dataset in this example, test names and test codes based specifically on this approach of identifying Major Rest Periods were used. None of these are in the current NV TESTCD/TEST codelists. 
NVTESTCDNVTESTDraft Definition
TSOTotal Sleep OpportunityThe duration of the major rest period. The major rest period corresponds to the time attempting to sleep.
TSTTSOTotal Sleep Time to Total Sleep Opportunity(Total Sleep Time) / (Total Sleep Opportunity)
TSTMRPTotal Sleep Time In Major Rest PeriodTotal time spent asleep in the major rest period.
WASOMRPWake Duration After Sleep Onset in Major Rest PeriodThe amount of time spent awake after first sleep state. (Includes time between (last) awakening and end of the major rest period.)
SOLMRPSleep Onset Latency in Major Rest PeriodTime between start of major rest period and (first) sleep onset.
NWMRPNumber of Wake Periods in Major Rest PeriodThe number of times the subject transitioned from sleep to wake, after first sleep state. (Includes the last wake period in the major rest period.)
  • In this example, scratch measurements are represented in the Musculoskeletal System Findings (MK) domain. This is consistent with the representation of the movement data in the DHT Step Count data in the MK domain.
  • There are no scratch tests in the current MKTESTCD/TEST codelists.  The tests used in this example are all specific to measuring scratching within the Major Rest Period identified by the sleep algorithms.
MKTESTCDMKTESTDraft Definition
NSCMRPNumber of Scratch Bouts in Major Rest PeriodTotal number of scratch bouts during the major rest period
DSCMRPDuration of Scratch Bouts in Major Rest PeriodTotal time spent scratching during the major rest period.
  • Sleep test concepts in the NCI Thesaurus currently have definitions which assume the concepts are being measured by polysomnography in the setting of a sleep study. In spite of this fact, the following existing concepts are treated as conceptual BCs associated with the SDTM specializations for the following tests used in this example:

Conceptual BCC-CodeSDTM Specialization Test CodeSDTM Specialization Test Name
Total Sleep TimeC156552TSTMRPTotal Sleep Time In Major Rest Period
Wake After Sleep OnsetC156554WASOMRPWake After Sleep Onset Major Rest Period
Sleep Onset LatencyC154867SOLMRPSleep Onset Latency in Major Rest Period
Sleep EfficiencyC156553TSTTSOTotal Sleep Time Total Sleep Opportunity
  • Other test concepts are not currently present in the NCI Thesaurus.  Conceptual BCs and SDTM Specializations have been represented as follows. "Cnew" is an indicator that a C-code does not currently exist, but is expected to be added in future.

Conceptual BCC-CodeSDTM Specialization Test CodeSDTM Specialization Test Name
Duration of Major Rest PeriodCnewTSOTotal Sleep Opportunity
Number of Nighttime AwakeningsCnewNWMRPNumber of Wake Periods Major Rest Period
  • Nocturnal Scratch measurements are not currently present in the NCI Thesaurus. Conceptual BCs and SDTM Specializations have been represented as follows.

Conceptual BCC-CodeSDTM Specialization Test CodeSDTM Specialization Test Name
Number of Nocturnal Scratch BoutsCnewNSCMRPNumber of Scratch Bouts in Major Rest Period
Duration of Nocturnal Scratch BoutsCnewDSCMRPDuration of Scratch Bouts in Major Rest Period

The example DI dataset shows how the devices modeled are described (parameters used) and the device identifiers (SPDEVID values) given to the devices. In the findings dataset summaries are produced by the device system, so only the identifier (SPDEVID) for the system as a whole is needed.

Row 1: Shows the device type for the system of two sensors used in this study.

Rows 2-4: Show identifying parameters for the right sensor

Rows 9-12: How identifying parameters for the left sensor.

RowSTUDYIDDOMAINSPDEVIDDISEQDIPARMCDDIPARMDIVAL
1ABC-123DIScratch Sensor System1DEVTYPEDevice TypeKinesiology ambulatory recorder system
2ABC-123DIRight Sensor1DEVTYPEDevice TypeKinesiology ambulatory recorder
3ABC-123DIRight Sensor2MANUFManufacturerSomeone
4ABC-123DIRight Sensor3WEARLOCWear LocationRight Wrist
5ABC-123DILeft Sensor1DEVTYPEDevice TypeKinesiology ambulatory recorder
6ABC-123DILeft Sensor2MANUFManufacturerSomeone
7ABC-123DILeft Sensor3WEARLOCWear LocationLeft Wrist

Relevant sleep data from the device have been mapped to the following Nervous System Findings (NV) domain. Nocturnal Scratch data have been mapped to the Musculoskeletal System Findings (MK) domain.

  • SPDEVID (Device Identifier) is defined in the Device Identifier (DI) above. In this study, the implementer chose to use an identifier that identified the combination of the two wrist-worn sensors.
  • None of the test names and codes used in this example are in CDISC Controlled Terminology.
  • If the device quality check returned a value of "FAIL", this is represented in a record with --STAT = "NOT DONE" and --REASND = "FAIL". The meaning of "FAIL" could be further described in the clinical data reviewer's guide.
  • The sensor data is summarized over 24 hour periods from noon to noon. These wear periods are represented with --ENDTC and --ENENDTC. 
  • After algorithms have identified the major rest period, summaries of sleep and scratch within that period are calculated. The fact that those summaries cover the major rest period is represented in --EVINTX = "TOTAL SLEEP OPPORTUNITY".
  • The variable --NAM is used to represent the "lab" within the sponsor organization that performed summarization of the device data. This abbreviation used to populate --NAM would be explained the clinical data reviewer's guide.
  • The algorithms used by the sponsor to analyze the device data are represented by --ANMETH = "SPONSOR ALGORITHMS". The sponsor would supply needed information about these algorithms in the clinical data reviewer's guide.

     

nv.xpt

Rows 1-6: Show that sleep-related measurements for the day starting at noon on 2018-11-30 were not done.

Rows 7-12: Show the sleep-related measurements for the day starting at noon on 2018-12-01.

nv.xpt

RowSTUDYIDDOMAINUSUBJIDSPDEVIDNVSEQNVREFIDNVTESTCDNVTESTNVORRESNVORRESUNVSTRECNVSTRESNNVSTRESUNVSTATNVREASNDNVNAMNVLOCNVLATNVMETHODNVANMETHNVDTCNVENDTCNVEVINTX
1ABC-123NV1001Scratch Sensor System101 TSOTotal Sleep Opportunity     NOT DONEFAILSPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-11-30T12:002018-12-01T11:59MAJOR REST PERIOD
2ABC-123NV1001Scratch Sensor System102 TSTMRPTotal Sleep Time in Major Rest Period     NOT DONEFAILSPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-11-30T12:002018-12-01T11:59MAJOR REST PERIOD
3ABC-123NV1001Scratch Sensor System103 TSTTSOTotal Sleep Time Total Sleep Opportunity     NOT DONEFAILSPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-11-30T12:002018-12-01T11:59MAJOR REST PERIOD
4ABC-123NV1001Scratch Sensor System104 SOLMRPSleep Onset Latency Major Rest Period     NOT DONEFAILSPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-11-30T12:002018-12-01T11:59MAJOR REST PERIOD
5ABC-123NV1001Scratch Sensor System105 WASOMRPWake After Sleep Onset Major Rest Period     NOT DONEFAILSPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-11-30T12:002018-12-01T11:59MAJOR REST PERIOD
6ABC-123NV1001Scratch Sensor System106 NWMRPNumber Wake Bouts Major Rest Period     NOT DONEFAILSPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-11-30T12:002018-12-01T11:59MAJOR REST PERIOD
7ABC-123NV1001Scratch Sensor System107 TSOTotal Sleep Opportunity658MINUTES658658MINUTES  SPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-12-01T12:002018-12-02T11:59MAJOR REST PERIOD
8ABC-123NV1001Scratch Sensor System108 TSTMRPTotal Sleep Time in Major Rest Period601MINUTES601601MINUTES  SPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-12-01T12:002018-12-02T11:59MAJOR REST PERIOD
9ABC-123NV1001Scratch Sensor System109 TSTTSOTotal Sleep Time Total Sleep Opportunity91.489%91.48991.489%  SPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-12-01T12:002018-12-02T11:59MAJOR REST PERIOD
10ABC-123NV1001Scratch Sensor System110 SOLMRPSleep Onset Latency Major Rest Period1.5MINUTES1.51.5MINUTES  SPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-12-01T12:002018-12-02T11:59MAJOR REST PERIOD
11ABC-123NV1001Scratch Sensor System111 WASOMRPWake After Sleep Onset Major Rest Period52MINUTES5252MINUTES  SPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-12-01T12:002018-12-02T11:59MAJOR REST PERIOD
12ABC-123NV1001Scratch Sensor System112 NWMRPNumber Wake Bouts Major Rest Period15 1515   SPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-12-01T12:002018-12-02T11:59MAJOR REST PERIOD
mk.xpt

Rows 1-2: Show that scratch data for the day starting at noon on 2018-11-30 were not done

Rows 3-4: Show the scratch data for the day starting at noon on 2018-12-01.

mk.xpt

RowSTUDYIDDOMAINUSUBJIDSPDEVIDMKSEQMKREFIDMKTESTCDMKTESTMKORRESMKORRESUMKSTRECMKSTRESNMKSTRESUMKSTATMKREASNDMKNAMMKLOCMKLATMKMETHODMKANMETHMKDTCNMKENDTCMKEVINTX
1ABC-123MK1001Scratch Sensor System41 NSCMRPNumber Scratch Bouts Major Rest Period     NOT DONEFAILSPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-11-30T12:002018-12-01T11:59MAJOR REST PERIOD
2ABC-123MK1001Scratch Sensor System42 DSCMRPDuration Scratch Bouts Major Rest Period     NOT DONEFAILSPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-11-30T12:002018-12-01T11:59MAJOR REST PERIOD
3ABC-123MK1001Scratch Sensor System44 NSCMRPNumber Scratch Bouts Major Rest Period220 220220   SPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-12-01T12:002018-12-02T11:59MAJOR REST PERIOD
4ABC-123MK1001Scratch Sensor System45 DSCMRPDuration Scratch Bouts Major Rest Period14.3MINUTES14.314.3MINUTES  SPDDADWRISTBOTHACTIGRAPHYSPONSOR SLEEP ALGORITHMS2018-12-01T12:002018-12-02T11:59MAJOR REST PERIOD